The domain within your query sequence starts at position 282 and ends at position 355; the E-value for the PAP2_C domain shown below is 1.7e-30.

MCGDYLYSGHTVMLTLTYLFIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVV
AYYITTRLFWWYHT

PAP2_C

PAP2_C
PFAM accession number:PF14360
Interpro abstract (IPR025749):

This domain is found in sphingomyelin synthase (also known as phosphatidylcholine:ceramide cholinephosphotransferase), and other proteins. Sphingomyelin synthase is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa [(PUBMED:14685263)]. This domain is closely related to the C-terminal a region of phosphatidic acid phosphatase type 2 (PAP2).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAP2_C