SMART: Pfam domain PARM

The domain within your query sequence starts at position 15 and ends at position 296; the E-value for the PARM domain shown below is 5.3e-120.

GLRVQGSPTVPLPVSLMTKSSAPVATWTTSAPHTARATTPVASATHNASVLRTTAASLTS
QLPTDHREEAVTSPPLKRDVNSTDSSPAGFPSTSSDGHLAPTPEEHSLGSPEATVPATGS
QSPMLLSSQAPTSATTSPATSLSESLSASVTSSHNSTVANIQPTEAPMAPASPTEEHSSS
HTPTSHVTAEPVPKEKSPQDTEPGKVICESETTTPFLIMQEVENALSSGSIAAITVTVIA
VVLLVFGGAAYLKIRHSSYGRLLDDHDYGSWGNYNNPLYDDS

PARM

PFAM accession number:	PF17061
Interpro abstract (IPR031431):	Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein present in most tissues, with high levels in the heart, kidney and placenta [ (PUBMED:18027867) ]. It is induced and expressed in prostate after castration [ (PUBMED:10499539) ] and may have a role in cell proliferation and immortalisation in prostate cancer [ (PUBMED:18027867) (PUBMED:12772192) ]. PARM-1 also contributes to ovulation and/or luteal function by acting as a novel regulator of progesterone metabolism [ (PUBMED:24085821) ].

PFAM accession number:

PF17061

Interpro abstract (IPR031431):

Human PARM-1 is a mucin-like, androgen-regulated transmembrane protein present in most tissues, with high levels in the heart, kidney and placenta [ (PUBMED:18027867) ]. It is induced and expressed in prostate after castration [ (PUBMED:10499539) ] and may have a role in cell proliferation and immortalisation in prostate cancer [ (PUBMED:18027867) (PUBMED:12772192) ]. PARM-1 also contributes to ovulation and/or luteal function by acting as a novel regulator of progesterone metabolism [ (PUBMED:24085821) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PARM