The domain within your query sequence starts at position 247 and ends at position 490; the E-value for the PAT1 domain shown below is 6.7e-12.

KLVTPYIQKPEVYESVVRIEGSLGQVAVSTCFSPRRAIDAVSHGTQEQDTGAASSQRLRV
LSQIEKMFLQLLKIEEGQNDGLPQLYHTREQSSQVEKLFQALKTQEQNNLEEAADNLLQV
LSVRKGKVLVARLLPFLPPDQAVSLLLYITYHLPLLIQRDMADQGLHMLFKPLGKYISHL
TFHQLLHAMQGLMLLSPGSSERPVSVVLQNQFGISLLYALLSHGEQLVSLDPSLRSSSDC
ATWT

PAT1

PAT1
PFAM accession number:PF09770
Interpro abstract (IPR019167):

Proteins in this entry are necessary for accurate chromosome transmission during cell division [(PUBMED:8972867)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAT1