The domain within your query sequence starts at position 28 and ends at position 422; the E-value for the PAXNEB domain shown below is 4e-123.
SFQRKGKASGGPGGGPRLLSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTLLLIEE DKYNIYSPLLFKYFMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSA KTPEPNVNMKIAWRYQLQPKMEVGPVSSSRFGHYYDLSKRIPWELLQSSKWHGFFLPEHI SPDLKGESCFLSCGYMRLLEFIQKSVYAEGFDGANPQKKQKNILRIGIQNLGSPLWGDDI CCKENCDNNHRLTKFLYILRGLLRSSLSACIITMPAHLVQNKSITTRVRNLSDTVVGLES FIGSERETNPLYKDYHGLIHIRKIPRLNNLTCDESDVKDLAFKLKRKLFTIERLHLPPDL SDTVGRSSKQDLAASTARLGAGCSSMAEGKKHLDF
PAXNEB |
---|
PFAM accession number: | PF05625 |
---|---|
Interpro abstract (IPR008728): | Elongator is a 6 subunit protein complex highly conserved in eukaryotes. The human Elongator six-subunit complex, known as holo-Elongator, has histone acetyltransferase activity directed against histone H3 and H4 [ (PUBMED:11714725) (PUBMED:11904415) ]. It consists of two subcomplexes, a core subcomplex (ELP1-3), and an accessory subcomplex (ELP4-6) [ (PUBMED:22556426) ]. The elongator complex has been associated with many cellular activities, including transcriptional elongation [ (PUBMED:10024884) (PUBMED:11689709) ], but its main function is tRNA modification [ (PUBMED:15769872) (PUBMED:23165209) ]. It is required for the formation of 5-methoxy-carbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups on uridine nucleosides present at the wobble position of many tRNAs [ (PUBMED:22889844) ]. This entry represents the ELP4 subunit. Mammalian ELP4 gene is implicated in rolandic epilepsy [ (PUBMED:19172991) ]. |
GO process: | tRNA wobble uridine modification (GO:0002098) |
GO component: | Elongator holoenzyme complex (GO:0033588) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAXNEB