The domain within your query sequence starts at position 28 and ends at position 422; the E-value for the PAXNEB domain shown below is 4e-123.

SFQRKGKASGGPGGGPRLLSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTLLLIEE
DKYNIYSPLLFKYFMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSA
KTPEPNVNMKIAWRYQLQPKMEVGPVSSSRFGHYYDLSKRIPWELLQSSKWHGFFLPEHI
SPDLKGESCFLSCGYMRLLEFIQKSVYAEGFDGANPQKKQKNILRIGIQNLGSPLWGDDI
CCKENCDNNHRLTKFLYILRGLLRSSLSACIITMPAHLVQNKSITTRVRNLSDTVVGLES
FIGSERETNPLYKDYHGLIHIRKIPRLNNLTCDESDVKDLAFKLKRKLFTIERLHLPPDL
SDTVGRSSKQDLAASTARLGAGCSSMAEGKKHLDF

PAXNEB

PAXNEB
PFAM accession number:PF05625
Interpro abstract (IPR008728):

Elongator is a 6 subunit protein complex highly conserved in eukaryotes. The human Elongator six-subunit complex, known as holo-Elongator, has histone acetyltransferase activity directed against histone H3 and H4 [(PUBMED:11714725), (PUBMED:11904415)]. It consists of two subcomplexes, a core subcomplex (ELP1-3), and an accessory subcomplex (ELP4-6) [(PUBMED:22556426)]. The elongator complex has been associated with many cellular activities, including transcriptional elongation [(PUBMED:10024884), (PUBMED:11689709)], but its main function is tRNA modification [(PUBMED:15769872), (PUBMED:23165209)]. It is required for the formation of 5-methoxy-carbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups on uridine nucleosides present at the wobble position of many tRNAs [(PUBMED:22889844)].

This entry represents the ELP4 subunit. Mammalian ELP4 gene is implicated in rolandic epilepsy [(PUBMED:19172991)].

GO process:tRNA wobble uridine modification (GO:0002098)
GO component:Elongator holoenzyme complex (GO:0033588)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAXNEB