The domain within your query sequence starts at position 10 and ends at position 205; the E-value for the PAXX domain shown below is 5.7e-93.

LCILPPGSGSPRLVCYCERDSGGDGDRDDFNLYVTDAAELWSTCFSPDSLARLKARFGLS
GAEDIHSRFRAACQQQAVTVSLQEDRALITLSGDTPALAFDLSKVPSPEAAPRLQALTLS
LAEHVCNLERRLAAAEETITSPKKNTQPAGTQFLPELDHQRGSSGPGVRRRCPGESLINP
GFKSKKPAAGVDFDET

PAXX

PAXX
PFAM accession number:PF15384
Interpro abstract (IPR027873):

Protein PAXX is involved in DNA double-strand break (DSB) repair. PAXX interacts directly with the DSB-repair protein Ku and is recruited to DNA-damage sites in cells [(PUBMED:25574025)].

GO process:double-strand break repair via nonhomologous end joining (GO:0006303)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAXX