The domain within your query sequence starts at position 38 and ends at position 234; the E-value for the PBC domain shown below is 8.5e-103.
DGDGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRG AQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLT QIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQL KQSTCEAVMILRSRFLD
PBC |
---|
PFAM accession number: | PF03792 |
---|---|
Interpro abstract (IPR005542): | Pbx proteins are members of the TALE (three-amino-acid loop extension) family of atypical homeodomain proteins, whose members are characterised by a three-residue insertion in the first helix of the homeodomain involved in their interaction with Hox proteins. Examination of Pbx1 has shown that, in addition to the homeodomain, a short 16-residue C-terminal tail is essential for maximal cooperative interactions with Hox partners as well as for maximal monomeric binding of Pbx1 to DNA. The PBX domain is a bipartite acidic domain [ (PUBMED:1363814) ]. |
GO component: | nucleus (GO:0005634) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PBC