The domain within your query sequence starts at position 1 and ends at position 254; the E-value for the PC-Esterase domain shown below is 5.1e-53.

MVRLLASEVQQLLHNKFVVVLGDSVHRAVYKDLVLLLQKDCLLTNKQLRTKGELSFEKDQ
LKMGGELDTLHNRTDYREVREFCSDHHLVRFYFLTRVYSEYMESVLEELQSGNHAPDVII
MNSCLWDVSRYGRNSLSSYKQNLENLFGRMDQVLPKSCLLVWNTAMPLGDKIKAAFLPQK
CKGQYPRISVATLKRKVTQANLYSHAEATKHYFDVLDLNFHFRQARKHLQGDGVHWNEHA
HRKLSYLLLAHMAD

PC-Esterase

PC-Esterase
PFAM accession number:PF13839
Interpro abstract (IPR026057):

The PC-Esterase family [(PUBMED:20056006)] is comprised of Cas1p, the Homo sapiens C7orf58, Arabidopsis thaliana PMR5 and a group of plant freezing resistance/cold acclimatization proteins typified by Arabidopsis thaliana ESKIMO1 [(PUBMED:20657172), (PUBMED:21408051)], animal FAM55D proteins, and animal FAM113 proteins. The PC-Esterase family has features that are both similar and different from the canonical GDSL/SGNH superfamily [(PUBMED:20056006)]. The members of this family are predicted to have Acyl esterase activity and predicted to modify cell-surface biopolymers such as glycans and glycoproteins [(PUBMED:20056006), (PUBMED:21408051)]. The Cas1p protein has a Cas1_AcylT domain, in addition, with the opposing acyltransferase activity [(PUBMED:20056006)]. The C7orf58 family has a ATP-Grasp domain fused to the PC-Esterase and is the first identified secreted tubulin-tyrosine ligase like enzyme in eukaryotes [(PUBMED:20056006)]. The plant family with PMR5, ESK1, TBL3 etc have an N-terminal C rich potential sugar binding domain followed by the PC-Esterase domain [(PUBMED:20056006)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC-Esterase