The domain within your query sequence starts at position 1369 and ends at position 1999; the E-value for the PCM1_C domain shown below is 3.6e-295.

GSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVS
RHISESDEREGENVKPVNSGTWVASNSELTPSESLVTTDDETFEKNFERETHKVSEQNDA
DNVSVMSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTETESHSNMRCTCRVIEDE
DGAAAAATVSNSEETPIIENHNSPQPISDVSAVPCPRIDTQQLDRQIKAIMKEVIPFLKE
HMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGE
DLLVEISEVLFNELAFFKLMQDLDNNSIAVKQRCKRKIEAAGVRQSYAKEAKRILEGDHG
SPAGEIDDEDKDKDETETVKQTQTSEVYDAKGPKNVRSDVSDQEEDEESERCPVSINLSK
AESQALTNYGSGEDENEDEEMEDFEESPVDIQTSLQANTETTEENEHDSQILQHDLEKTP
ESTNVPSDQEPTSKNDQDSSPVKPCYLNILENEQQLNSATHKDSLTTTDSSKQPEPLPLP
LAASETLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVE
DLPLKLTVYSEEELRKKMIEEEQKNHLSGEI

PCM1_C

PCM1_C
PFAM accession number:PF15717
Interpro abstract (IPR031446): This entry represents the C-terminal domain of pericentriolar material 1 (PCM1), a protein involved in the assembly of centrosomal proteins and microtubule organisation [(PUBMED:12403812)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PCM1_C