The domain within your query sequence starts at position 438 and ends at position 474; the E-value for the PC_rep domain shown below is 6.8e-9.

GALLACGIVNSGVQNECDPALALLSDYVLHNSNTMRL

PC_rep

PC_rep
PFAM accession number:PF01851
Interpro abstract (IPR002015): A weakly conserved repeat module of unknown function, which occurs in two regulatory subunits of the 26S-proteasome and in one subunit of the anaphase-promoting complex [(PUBMED:9204704)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC_rep