The domain within your query sequence starts at position 192 and ends at position 356; the E-value for the PDCD2_C domain shown below is 3e-44.

FQPYYICVAEEEDYGSVVDLDHAHSLLQEYQRREGVDMEQLLSLGSSDGDEKYEKTTVSS
GDPTFYRFMKRIAACQEQILRYSWSGEPLFLSCPTFEVSEVPACSGCGGQRTFEFQLMPA
LVSMLSSANLGLAVEFGTILVYTCKQSCWPPNQQMPMEEFCVLQE

PDCD2_C

• PFAM accession number: PF04194
• Interpro abstract (IPR007320):

  PDCD2 is localized predominantly in the cytosol of cells situated at the opposite pole of the germinal centre from the centroblasts as well as in cells in the mantle zone. It has been shown to interact with BCL6, an evolutionarily conserved Kruppel-type zinc finger protein that functions as a strong transcriptional repressor and is required for germinal centre development. The rat homologue, Rp8, is associated with programmed cell death in thymocytes.

• GO component: cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PDCD2_C