The domain within your query sequence starts at position 30 and ends at position 336; the E-value for the PDDEXK_1 domain shown below is 4.7e-12.

FSYLCSQKKKNSYEAVDQAKYSRLVRSVLSRGPAQTPESLFKEDDVLYGPVSKHKAAEPE
PQARVPQHCFPIFNEERTGKPHTDASSSPLKIPLQRNSIPSVTRILQQTMPPEQSFFLER
WKERMVLELGEDGFAEYTSNVFLQGKQFHKALESILSPQENLTGGEEHPQCGYIESIQHI
LTEISGVQALESAVQHEALKYVGLLDCVAEYRGKLCVIDWKTSEKPKPLIRNTYDNPLQV
VAYMGAVNHDAHYSFQVQCGLIVVAYKDGSPAHPHFMDEELCSKYWAKWLLRLEEYTEKQ
KNLSAPE

PDDEXK_1

PDDEXK_1
PFAM accession number:PF12705
Interpro abstract (IPR038726):

This entry represent a PD-(D/E)XK endonuclease-like domain [(PUBMED:15972856)]. PD-(D/E)XK nucleases constitute a large and highly diverse superfamily of enzymes that display little sequence similarity despite retaining. However, they share a common core fold and a few critical active site residues [(PUBMED:17584917)]. This domain can be found at the C terminus of nuclease/helicase AddA, AddB, and RecB.

There are two classes of helicase-nuclease complex involved in the initiation step for recombinational repair. AddAB-type enzymes (also called RexAB) are found mainly in Gram-positive bacteria, whereas heterotrimeric RecBCD-type enzymes are found mainly in Gram-negative bacteria [(PUBMED:17570399)]. The RecBCD holoenzyme has a single nuclease domain found in RecB [(PUBMED:10617645)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PDDEXK_1