The domain within your query sequence starts at position 2 and ends at position 74; the E-value for the PDE6_gamma domain shown below is 1.5e-41.

SDSPSLSPPAPSQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDIT
VICPWEAFSHLE

PDE6_gamma

PDE6_gamma
PFAM accession number:PF04868
Interpro abstract (IPR006952):

Retinal rod and cone cGMP phosphodiesterases function as the effector enzymes in the vertebrate visual transduction cascade. This family represents the inhibitory gamma subunit [ (PUBMED:11900530) ], which is also expressed outside retinal tissues and has been shown to interact with the G-protein-coupled receptor kinase 2 signalling system to regulate the epidermal growth factor- and thrombin-dependent stimulation of p42/p44 mitogen-activated protein kinase in human embryonic kidney 293 cells [ (PUBMED:11502744) ].

GO process:visual perception (GO:0007601)
GO function:3',5'-cyclic-nucleotide phosphodiesterase activity (GO:0004114), cGMP binding (GO:0030553)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PDE6_gamma