The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the PDE8 domain shown below is 1.4e-32.

MGCAPSIHVSQSGVIYCRDSDESNSPRQTSSVSQGPTAPLHGLFVQT

PDE8

PDE8
PFAM accession number:PF08629
Interpro abstract (IPR013938):

The cyclic nucleotide phosphodiesterases (PDE) comprise a group of enzymes that degrade the phosphodiester bond in the second messenger molecules cAMP and cGMP. They are divided into 11 families. They regulate the localisation, duration and amplitude of cyclic nucleotide signalling within subcellular domains. PDEs are therefore important for signal transduction.

PDE enzymes are often targets for pharmacological inhibition due to their unique tissue distribution, structural properties, and functional properties. Inhibitors include: Roflumilast for chronic obstructive pulmonary disease and asthma [(PUBMED:18447606)], Sildenafil for erectile dysfunction [(PUBMED:18367027)] and Cilostazol for peripheral arterial occlusive disease [(PUBMED:18436153)], amongst others.

Retinal 3',5'-cGMP phosphodiesterase is located in photoreceptor outer segments: it is light activated, playing a pivotal role in signal transduction. In rod cells, PDE is oligomeric, comprising an alpha-, a beta- and 2 gamma-subunits, while in cones, PDE is a homodimer of alpha chains, which are associated with several smaller subunits. Both rod and cone PDEs catalyse the hydrolysis of cAMP or cGMP to the corresponding nucleoside 5' monophosphates, both enzymes also binding cGMP with high affinity. The cGMP-binding sites are located in the N-terminal half of the protein sequence, while the catalytic core resides in the C-terminal portion.

This region is found at the N terminus of members of PDE8 phosphodiesterase family [(PUBMED:9784418)]. Phosphodiesterase 8 (PDE8) regulates chemotaxis of activated lymphocytes [(PUBMED:16696947)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PDE8