The domain within your query sequence starts at position 158 and ends at position 263; the E-value for the PEMT domain shown below is 2.6e-11.

WLSATGLLMVVFGECLRKAAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWF
YWSIGTQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIHFFGEEY

PEMT

PEMT
PFAM accession number:PF04191
Interpro abstract (IPR007318):

This family includes Saccharomyces cerevisiae phospholipid methyltransferase EC 2.1.1.16, which has a broad substrate specificity of unsaturated phospholipids [(PUBMED:2445736)], and related enzymes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEMT