The domain within your query sequence starts at position 89 and ends at position 128; the E-value for the PEMT domain shown below is 4.2e-9.
TTYFLGLAFLGWGFVFVLSSFYALGFTGTFLGDYFGILKE
PEMT |
---|
PFAM accession number: | PF04191 |
---|---|
Interpro abstract (IPR007318): | This family includes Saccharomyces cerevisiae phospholipid methyltransferase EC 2.1.1.16 which has a broad substrate specificity of unsaturated phospholipids [ (PUBMED:2445736) ], and related enzymes such as methanethiol S-methyltransferase ( EC 2.1.1.334 ), which catalyzes the methylation of methanethiol to yield dimethylsulphide (a volatile compound important in climate regulation) [ (PUBMED:25807229) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEMT