The domain within your query sequence starts at position 1 and ends at position 172; the E-value for the PEX11 domain shown below is 4.5e-57.

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLEGHLSLGRKLLR
LGNSTDALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA
QRSFRYYLFSLIMNLSRDAYEIRLLMEQETSAYSRRMKVSGVGVSGGVETVG

PEX11

PEX11
PFAM accession number:PF05648
Interpro abstract (IPR008733):

This family consists of several peroxisomal biogenesis factor 11 (PEX11) proteins from several eukaryotic species. The PEX11 peroxisomal membrane proteins promote peroxisome division in multiple eukaryotes [(PUBMED:12417726)]. PEX11 genes in rice have diversification not only in sequences but also in expression patterns under normal and various stress conditions [(PUBMED:18291602)].

GO process:peroxisome fission (GO:0016559)
GO component:integral component of peroxisomal membrane (GO:0005779)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEX11