The domain within your query sequence starts at position 1041 and ends at position 1259; the E-value for the PGAP1 domain shown below is 8.1e-5.

DGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRLLD
EIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTLYN
SSALVNTGLWFMQKWKKSGSLLQLTCRDHSDPRQTFLYKLSNKAGLHYFKNVVLVGSLQD
RYVPYHSARIEMCKTALKDKQSGQIYSEMIHNLLRPVLQ

PGAP1

PGAP1
PFAM accession number:PF07819
Interpro abstract (IPR012908):

The sequences found in this family are similar to PGAP1 (Q765A7). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [(PUBMED:14734546)].

This entry also includes Tgl2, a mitochondria protein that serves as a triacylglycerol lipase in budding yeasts [(PUBMED:19959834)].

GO function:hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PGAP1