The domain within your query sequence starts at position 1 and ends at position 167; the E-value for the PGC7_Stella domain shown below is 8.9e-68.

MDPLQKWDPMSISVPSCIATVSSSQEASAAPQPSSSEKLSMGLSILSVSPSPRSSVPASL
SEGLFQQQAREKKALWQQYWEKQGFPQRKKVFLRHSRRWHRDHMAPYLLERDLRGFPSGD
KAQNQLRCQGHVQNIAGMSGQKNAAPNPPSWEMLVQGLNGLTLSLGA

PGC7_Stella

PGC7_Stella
PFAM accession number:PF15549
Interpro abstract (IPR029096):

Dppa3 (developmental pluripotency-associated protein 3), also known as Stella or PGC7, belongs to family known only in placental mammals [ (PUBMED:14654002) (PUBMED:14990856) (PUBMED:17143267) ]. The PGC7/Stella/Dppa3 protein protects imprinted regions from demethylation post-fertilization [ (PUBMED:17143267) ]. This suggests that it might bind methylated DNA sequences directly [ (PUBMED:21507349) ]. Dppa3 also seems to be involved in the demethylation process during reprogramming of embryonic germ cell precursors [ (PUBMED:23595900) ]. Most placental mammals contain 3-6 paralogues of this family.

The conserved core of Dppa3 includes a positively charged helical segment and a C-terminal CXCXXC motif that is predicted to chelate a metal ion [ (PUBMED:21507349) ]. The CXCXXC motif is also conserved in a subset of fungal MBD4-like proteins [ (PUBMED:21507349) ].

GO function:methylated histone binding (GO:0035064)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PGC7_Stella