The domain within your query sequence starts at position 2139 and ends at position 2202; the E-value for the PHD_3 domain shown below is 9.8e-28.

ATSTGLTGQNTQMPVQNFADNSNADELELKCSCRLKAMIVCKGCGAFCHDDCIGPSKLCV
ACLV

PHD_3

PHD_3
PFAM accession number:PF13922
Interpro abstract (IPR026905):

This entry represetnts the PHD domain, a DNA-binding domain, on the additional sex combs (ASX) and additional sex combs-like (AsxL) proteins [(PUBMED:16412590)]. The Asx protein acts as an enhancer of trithorax and polycomb in displaying bidirectional homoeotic phenotypes in Drosophila, suggesting that it is required for maintenance of both activation and silencing of Hox genes. Asx is required for normal adult haematopoiesis and its function depends on its cellular context [(PUBMED:19833123)].

GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHD_3