The domain within your query sequence starts at position 202 and ends at position 241; the E-value for the PHF12_MRG_bd domain shown below is 1.3e-21.

VQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS

PHF12_MRG_bd

PHF12_MRG_bd
PFAM accession number:PF16737
Interpro abstract (IPR031966):

This domain found in PHF12 (PHD finger protein 12, also known as Pf1) binds to the MRG domain of mortality factor 4-like protein 1 (MORF4L1, also known as MRG15) [(PUBMED:22244764)]. In mammals, the corepressor Sin3B, the histone deacetylase HDAC1, MRG15 and Pf1 form a complex that plays important roles in regulation of transcription [(PUBMED:21041482)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHF12_MRG_bd