The domain within your query sequence starts at position 1 and ends at position 104; the E-value for the PHF5 domain shown below is 1.8e-53.
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKK
PHF5 |
 |
|---|
| PFAM accession number: | PF03660 |
|---|---|
| Interpro abstract (IPR005345): | Phf5 is a member of a novel murine multigene family that is highly conserved during evolution and belongs to the superfamily of PHD-finger proteins. At least one example, from Mus musculus (mouse), may act as a chromatin-associated protein [ (PUBMED:14762117) ]. The Schizosaccharomyces pombe (fission yeast) ini1 gene is essential, required for splicing [ (PUBMED:12054543) ]. It is localised in the nucleus, but not detected in the nucleolus and can be complemented by human ini1 [ (PUBMED:12054543) ]. The proteins of this family contain five CXXC motifs. |
| GO process: | mRNA splicing, via spliceosome (GO:0000398) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHF5