The domain within your query sequence starts at position 261 and ends at position 327; the E-value for the PHM7_cyt domain shown below is 8.2e-12.
LCYSVAKLIYLCKERKKTEKSLTYYTNLQAKTGRRTLINPKPCGQFCCCEVQGCEREDAI SYYTRMN
PHM7_cyt |
![]() |
---|
PFAM accession number: | PF14703 |
---|---|
Interpro abstract (IPR027815): | This is the predicted cytosolic domain of integral membrane proteins, such as yeast PHM7 and TM63A_HUMAN TRANSMEMBRANE PROTEIN 63A, O94886 . This domain usually preceeds the 7TM region and follows a RSN1_TM. Fold recognition programs consistenly and with high significance predict this domain to be distantly homologous to RNA binding proteins from the RRM clan [ (PUBMED:18552845) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHM7_cyt