The domain within your query sequence starts at position 274 and ends at position 344; the E-value for the PHM7_cyt domain shown below is 9.1e-10.

PCYNVARLMFLDAERKKAERGKLYFTNLQSKENVPAMINPKPCGHLCCCVVRGCEQVEAI
EYYTKLEQRLK

PHM7_cyt

PHM7_cyt
PFAM accession number:PF14703
Interpro abstract (IPR027815):

This is the predicted cytosolic domain of integral membrane proteins, such as yeast PHM7 and TM63A_HUMAN TRANSMEMBRANE PROTEIN 63A, O94886. This domain usually preceeds the 7TM region and follows a RSN1_TM. Fold recognition programs consistenly and with high significance predict this domain to be distantly homologous to RNA binding proteins from the RRM clan [(PUBMED:18552845)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHM7_cyt