The domain within your query sequence starts at position 43 and ends at position 667; the E-value for the PHO4 domain shown below is 1.3e-132.

VGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLGAKVSETIRNGLIDVELYNET
QDLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKI
VMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGA
PLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSESPLMEKKSNL
KEDHEETKMAPGDVEHRNPVSEVVCATGPLRAVVEERTVSFKLGDLEEAPERERLPMDLK
EETSIDSTINGAVQLPNGNLVQFSQTVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAK
VGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGDEMETLTWPNADTKKRI
RMDSYTSYCNAVSDLHSESEMDMSVKAEMGLGDRKGSSGSLEEWYDQDKPEVSLLFQFLQ
ILTACFGSFAHGGNDVSNAIGPLVALYLVYKQEASTKAATPIWLLLYGGVGICMGLWVWG
RRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKK
AVDWRLFRNIFMAWFVTVPISGVIS

PHO4

PHO4
PFAM accession number:PF01384
Interpro abstract (IPR001204):

The PHO-4 family of transporters includes the phosphate-repressible phosphate permease (PHO-4) from Neurospora crassa which is probably a sodium-phosphate symporter [(PUBMED:7732001)]. This family also includes the human leukemia virus receptor.

GO process:phosphate ion transport (GO:0006817)
GO component:membrane (GO:0016020)
GO function:inorganic phosphate transmembrane transporter activity (GO:0005315)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHO4