The domain within your query sequence starts at position 1235 and ends at position 1385; the E-value for the PHR domain shown below is 8.2e-44.

NRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFELGPDGGDHET
DGDLLAETDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITT
DDGVIFQFKSSKKSNNGTDVNAGQIPQLLYR

PHR

PHR
PFAM accession number:PF08005
Interpro abstract (IPR012983):

This domain is called PHR as it was originally found in the E3 ubiquitin-protein ligase proteins PAM (O75592), highwire (Q9NB71) and RPM-1 (Q17551) [(PUBMED:12878161)]. This domain can be duplicated in the highwire, PAM and PRM sequences. The function of PHR is currently unclear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHR