The domain within your query sequence starts at position 358 and ends at position 508; the E-value for the PHR domain shown below is 4.3e-54.
NRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLG QNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTG AKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT
PHR |
![]() |
---|
PFAM accession number: | PF08005 |
---|---|
Interpro abstract (IPR012983): | This domain is called PHR as it was originally found in the E3 ubiquitin-protein ligase proteins PAM ( O75592 ), highwire ( Q9NB71 ) and RPM-1 ( Q17551 ) [ (PUBMED:12878161) ]. This domain can be duplicated in the highwire, PAM and PRM sequences. The function of PHR is currently unclear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHR