The domain within your query sequence starts at position 24 and ends at position 162; the E-value for the PHTB1_C domain shown below is 2.9e-45.

TVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSEL
EGNAVVSYSRPTGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPD
FANPSDDDQKMVAAFSHMR

PHTB1_C

PHTB1_C
PFAM accession number:PF14728
Interpro abstract (IPR028074):

This domain is found at the the C terminus of PTHB1 protein. This protein forms a part of the BBSome complex, which is required for ciliogenesis [(PUBMED:17574030)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHTB1_C