The domain within your query sequence starts at position 1 and ends at position 417; the E-value for the PHTB1_N domain shown below is 1.1e-166.

MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAG
GGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQ
YQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLL
PGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLN
IGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGT
INTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLG
TDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVS

PHTB1_N

PHTB1_N
PFAM accession number:PF14727
Interpro abstract (IPR028073):

This is the N-terminal domain of PTHB1 protein. This protein forms a part of the BBSome complex, which is required for ciliogenesis [(PUBMED:17574030)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PHTB1_N