The domain within your query sequence starts at position 6 and ends at position 871; the E-value for the PI3K_1B_p101 domain shown below is < 1e-12.

TTCTEDRIQHALERCLHGLSLGRRSAPWSAGLCLNCWSLQELVSRDPGHFLILLEQILQK
TQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYCSICRE
MLTFIDAELKAPGISYQRLVRAEQGLPVRSHRSSTVTVLLLNPVEVQAEFLAVADKLSTP
GQSPHGTYTTLLLHAFQATFGAHCDLPKLHRKLQSKTIEELEDIFTETTEAQELASGIGD
VAEAREWLRTKLQAVGEKAGFPGILDTASPGKLHTIPIPVARCYTYSWNQDSFDILQEVL
LKEQELLQPGILGDDEEEEEEDLEMDRHCAERDSLLSTSSLVSHDSTLLLTSSQASEPVL
SRQMLTTFVSGLSDGMDSGYVEDSEENSEWPQKPGSQKRQGHRRPGQKFNRFYKLLKSTS
QLVLRRDSRSLESSVDPTLPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQAKLTTQLPRWL
LAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLETSHPILTRFF
KLQFFYVPVKRSHGTSPSACPSSLSQASPLPADSLKYPSPTDLGMAPWEDSTNDISHYLG
MLDPWYERNVLGLMHLPPEVLCQQSLKADSRPLEGSATQLPILADMLLYYCRFAARPVLL
QVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGRGRKRLGIDDDREAVPLTLQII
YSKGAISGRSRWSNLEKVCTSVNLSKACQKPEELDSSMEALTLTLTEVVKRQNPKSKKGF
NQISTSYIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSSLPPERSF
SQPAETGSDLCSLLCLPIMTFSGALP

PI3K_1B_p101

PI3K_1B_p101
PFAM accession number:PF10486
Interpro abstract (IPR019522):

Phosphoinositide 3-kinase regulatory subunit5/6 are regulatory subunits of the PI3K gamma complex. Class I PI3Ks are dual-specific lipid and protein kinases involved in numerous intracellular signaling pathways [(PUBMED:11395417)].

GO component:phosphatidylinositol 3-kinase complex, class IB (GO:0005944)
GO function:1-phosphatidylinositol-3-kinase regulator activity (GO:0046935)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PI3K_1B_p101