The domain within your query sequence starts at position 1230 and ends at position 1459; the E-value for the PIEZO domain shown below is 2.3e-94.

LSCVFVEQMQSNFCWVIQLFSLVCTVKGYYDPKEMMTRDRDCLLPVEEAGIIWDSICFFF
LLLQRRIFLSHYFLHVSADLKATALQASRGFALYNAANLKSINFHRQIEEKSLAQLKRQM
KRIRAKQEKYRQSQASRGQLQSKDPQDPSQEPGPDSPGGSSPPRRQWWRPWLDHATVIHS
GDYFLFESDSEEEEEALPEDPRPAAQSAFQMAYQAWVTNAQTVLRQRRER

PIEZO

PIEZO
PFAM accession number:PF15917
Interpro abstract (IPR031805):

This domain is found in proteins belonging to the piezo family. Piezo proteins are components of cation channels [(PUBMED:20813920)]. This domain is found in association with IPR031334.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIEZO