The domain within your query sequence starts at position 43 and ends at position 152; the E-value for the PIG-P domain shown below is 1.2e-42.

PERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPVYLLITVVIG
YVLLFGINMMSTSPLDSIHTITDNYAKNQQRKNYQEDAIPALRDVPISE

PIG-P

PIG-P
PFAM accession number:PF08510
Interpro abstract (IPR013717):

PIG-P (phosphatidylinositol N-acetylglucosaminyltransferase subunit P) is an enzyme involved in GPI anchor biosynthesis [(PUBMED:10944123)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIG-P