The domain within your query sequence starts at position 72 and ends at position 115; the E-value for the PIGA domain shown below is 1.4e-18.

HAYGNRKGVRYLTNGLKVYYLPLRVMYNQSTATTLFHSLPLLRD

PIGA

 PIGA
PFAM accession number:PF08288
Interpro abstract (IPR013234):

This domain is found on phosphatidylinositol N-acetylglucosaminyltransferase proteins. These proteins are involved in GPI anchor biosynthesis and are associated with the disease paroxysmal nocturnal haemoglobinuria [ (PUBMED:12488505) ].

GO process:GPI anchor biosynthetic process (GO:0006506)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIGA