The domain within your query sequence starts at position 19 and ends at position 314; the E-value for the PIH1 domain shown below is 4.1e-30.

LDDLAENDPERYRNFIQQELKDGKQLCVNPEPQLCIQTKILKPNEKVLFINLCQWERIPA
PQSATRPVPVSVGRPEDSAEASDAYTIIDVAYNPGVLQAAEKDQGIKDQLIRMAMLCIEE
RLQFTLAHSYHLTSFRLKGSIQRMKESLMGIKTDFPDLKAMTRTENTLARIRSSTVSEPN
HLPEVLLTKKQASAKGRCLIEEISSSEIQVEVKKPAYELKVVKDRNEKPLKIELKVELPG
IKSVSLCELSVSEVDILIEVSEMYRLCLNLPESINTEMTTAKFVKNKSALIITMPL

PIH1

PIH1
PFAM accession number:PF08190
Interpro abstract (IPR012981):

Proteins containing the PIH1 domain include kintoun, Saccharomyces cerevisiae PIH1 (protein interacting with Hsp90 1, also known as Nop17) and PIH1 domain-containing proteins.

Kintoun is required for cytoplasmic pre-assembly of axonemal dyneins, thereby playing a central role in motility in cilia and flagella. It involved in pre-assembly of dynein arm complexes in the cytoplasm before intraflagellar transport loads them for the ciliary compartment [(PUBMED:19052621)].

PIH1 is a component of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1), which interacts with Hsp90 to mediate assembly large protein complexes such as box C/D snoRNPs and RNA polymerase II [(PUBMED:18268103)]. PTH1 is also involved in pre-rRNA processing and required for the NOP58-snoRNA interaction [(PUBMED:15670595)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIH1