The domain within your query sequence starts at position 123 and ends at position 270; the E-value for the PINIT domain shown below is 9.6e-35.
EVRLVKLPFFNMLDELLKPTELVPQSAEKLQESPCIFALTPRQVEMIRNSRELQPGVKAV QVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLM YLSSATNRITVTWGNYGKSYSVALYLVR
PINIT |
---|
PFAM accession number: | PF14324 |
---|---|
Interpro abstract (IPR023321): | This entry represents the PINIT domain, which serves as a scaffold to coordinate PCNA to promote SUMO conjugation to both consensus and nonconsensus lysine side chains [ (PUBMED:19748360) ]. This domain is found in the PIAS family of proteins [ (PUBMED:14596924) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PINIT