The domain within your query sequence starts at position 126 and ends at position 278; the E-value for the PINIT domain shown below is 1.1e-38.

DVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLPGAKCD
YTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINIT
PLARLSATVPNTIVVNWSSEFGRNYSLSVYLVR

PINIT

PINIT
PFAM accession number:PF14324
Interpro abstract (IPR023321):

This entry represents the PINIT domain, which serves as a scaffold to coordinate PCNA to promote SUMO conjugation to both consensus and nonconsensus lysine side chains [(PUBMED:19748360)]. This domain is found in the PIAS family of proteins [(PUBMED:14596924)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PINIT