The domain within your query sequence starts at position 197 and ends at position 399; the E-value for the PIP49_C domain shown below is 6.4e-62.
VWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGIPHGSWHGAVLLPALRPLLPSVL HRALQQWFGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTLANVGYTATYDFKMADL QQVAPEATVRRFLQGRHCEQSSDCIYGRDCRAPCDRLMRQCKGDLIQPNLAKVCELLRDY LLPGAPAGLYEELGKQLRTCTTL
PIP49_C |
---|
PFAM accession number: | PF12260 |
---|---|
Interpro abstract (IPR022049): | This is the C-terminal region of a family of FAM69 proteins from Metazoa and Viridiplantae that are active protein-kinases. The family members have a short transmembrane helix close to the N terminus, and thereafter are highly enriched with cysteines. FAM69 proteins are localised to the endoplasmic reticulum. Many members also have a short EF-hand, calcium-binding, domain just upstream of the kinase domain. The exact function of the more N-terminal family is uncertain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIP49_C