The domain within your query sequence starts at position 165 and ends at position 358; the E-value for the PIP5K domain shown below is 4.3e-49.

ATLGPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHS
LLARLLGVYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEGSPLVL
VLKDLNFQEKTMRLGAQRSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHHSV
FSTFKRTVTPAMLA

PIP5K

PIP5K
PFAM accession number:PF01504
Interpro abstract (IPR002498): This entry represents a conserved region from the common kinase core found in the type I phosphatidylinositol-4-phosphate 5-kinase (PIP5K) family as described in [(PUBMED:9535851)]. This region is found in I, II and III phosphatidylinositol-4-phosphate 5-kinases (PIP5K enzymes). PIP5K catalyses the formation of phosphoinositol-4,5-bisphosphate via the phosphorylation of phosphatidylinositol-4-phosphate a precursor in the phosphinositide signalling pathway.
GO process:phosphatidylinositol metabolic process (GO:0046488)
GO function:phosphatidylinositol phosphate kinase activity (GO:0016307)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIP5K