SMART: Pfam domain PKD

The domain within your query sequence starts at position 823 and ends at position 901; the E-value for the PKD domain shown below is 8e-13.

VVTTDGRLVAEQGHNATFIILMEEGDLQRTNIQLDFGDGVAVSYANFSPIEDGIRHVYKS
AGIFQVTAYAENNLGSDTA

PKD

PFAM accession number:	PF00801
Interpro abstract (IPR000601):	The polycystic kidney disease (PKD) domain is an 80-90 amino acid module originally found in 16 copies in the extracellular segment of polycystin-1, a large cell surface glycoprotein. Polycystin-1 is encoded by the PKD1 gene, which is mutated in autosomal dominant polycystic kidney disease (ADPKD). Although its function is unknown, it may be involved in protein-protein and protein-carbohydrate interactions based on its predicted domain structure. One or more copies of the PKD domain are also found in several other extracellular proteins from higher organisms, eubacteria, and archaebacteria. Singles copies of the PKD domain are found in the melanocytes heavily glycosylated cell-surface proteins Pmel 17, MMP and Nmp. Some bacterial collagenases and proteases also contain a single PKD domain adjacent to their catalytic domains, whereas four copies are present in the heavily glycosylated surface layer protein of archaebacteria [ (PUBMED:7663510) ]. The PKD modules are often observed, within a same protein sequence, in association with FnIII domains [ (PUBMED:10933504) ]. The most conserved motif is the WDFGDGS sequence that is found in the central part of many PKD domains and could play a structural role [ (PUBMED:7663510) (PUBMED:9889186) ]. Determination of the solution structure of the first PKD domain from human polycystin-1 has shown that the module is built from two beta-sheet, one of three strands and one of four strands, which are packed face-to-face [ (PUBMED:9889186) ].

PFAM accession number:

PF00801

Interpro abstract (IPR000601):

The polycystic kidney disease (PKD) domain is an 80-90 amino acid module originally found in 16 copies in the extracellular segment of polycystin-1, a large cell surface glycoprotein. Polycystin-1 is encoded by the PKD1 gene, which is mutated in autosomal dominant polycystic kidney disease (ADPKD). Although its function is unknown, it may be involved in protein-protein and protein-carbohydrate interactions based on its predicted domain structure. One or more copies of the PKD domain are also found in several other extracellular proteins from higher organisms, eubacteria, and archaebacteria. Singles copies of the PKD domain are found in the melanocytes heavily glycosylated cell-surface proteins Pmel 17, MMP and Nmp. Some bacterial collagenases and proteases also contain a single PKD domain adjacent to their catalytic domains, whereas four copies are present in the heavily glycosylated surface layer protein of archaebacteria [ (PUBMED:7663510) ]. The PKD modules are often observed, within a same protein sequence, in association with FnIII domains [ (PUBMED:10933504) ].

The most conserved motif is the WDFGDGS sequence that is found in the central part of many PKD domains and could play a structural role [ (PUBMED:7663510) (PUBMED:9889186) ]. Determination of the solution structure of the first PKD domain from human polycystin-1 has shown that the module is built from two beta-sheet, one of three strands and one of four strands, which are packed face-to-face [ (PUBMED:9889186) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PKD