The domain within your query sequence starts at position 398 and ends at position 645; the E-value for the PKD_channel domain shown below is 1.4e-12.

LGESLVMETQLSTFKGRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDV
VILSLYLASFALRLLLAGLAYMHCRDASDSTTCRYFTTAERSEWRTEDPQFLAEVLFAVT
SMLSFTRLAYILPAHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQES
EKLGNFNETFQFLFWTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAM
ITNSFQKI

PKD_channel

PKD_channel
PFAM accession number:PF08016
Interpro abstract (IPR013122):

Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys. Cyst development is associated with impairment of kidney function, and ultimately kidney failure and death [(PUBMED:8643665)]. Most cases of autosomal dominant PKD result from mutations in the PKD1 gene that cause premature protein termination.

A second gene for autosomal dominant polycystic kidney disease has been identified by positional cloning [(PUBMED:8650545)]. The predicted 968-amino acid sequence of the PKD2 gene product (polycystin-2) contains 6 transmembrane domains, with intracellular N- and C-termini. Polycystin-2 shares some similarity with the family of voltage-activated calcium (and sodium) channels, and contains a potential calcium-binding domain.

Polycystin-2 is strongly expressed in ovary, foetal and adult kidney, testis, and small intestine. Polycystin-1 requires the presence of this protein for stable expression and is believed to interact with it via its C terminus. All mutations between exons 1 and 11 result in a truncated polycystin-2 that lacks a calcium-binding EF-hand domain and the cytoplasmic domains required for the interaction of polycystin-2 with polycystin-1 [(PUBMED:9326320)]. PKD2, although clinically milder than PKD1, has a deleterious impact on life expectancy.

This entry contains proteins belonging to the polycystin family including Mucolipin and Polycystin-1 and -2 (PKD1 and PKD2). The domain contains the cation channel region of PKD1 and PKD2 proteins. PKD1 and PKD2 may function through a common signalling pathway that is necessary for normal tubulogenesis. The PKD2 gene product has six transmembrane spans with intracellular amino- and carboxyl-termini [(PUBMED:8650545)].

Mucolipin is a cationic channel which probably plays a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. It could play a major role in the calcium ion transport regulating lysosomal exocytosis [(PUBMED:11013137), (PUBMED:12459486), (PUBMED:14749347)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PKD_channel