The domain within your query sequence starts at position 2 and ends at position 56; the E-value for the PKI domain shown below is 7.5e-28.

MEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQAEG

PKI

PKI
PFAM accession number:PF02827
Interpro abstract (IPR004171): Members of this family are extremely potent competitive inhibitors of cAMP-dependent protein kinase activity. These proteins interact with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
GO process:negative regulation of protein kinase activity (GO:0006469)
GO function:cAMP-dependent protein kinase inhibitor activity (GO:0004862)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PKI