The domain within your query sequence starts at position 754 and ends at position 894; the E-value for the PKK domain shown below is 2.2e-37.
HQLVKQQLKDQYFLQRHDLLRKHEKEREQMQRYNQRMMEQLKVRQQQEKARLPKIQRSDG KTRMAMYKKSLHINGAGSASEQREKIKQFSQQEEKRQKAERLQQQQKHENQMRDMVAQCE SNMSELQQLQNEKCHLLVEHE
PKK |
---|
PFAM accession number: | PF12474 |
---|---|
Interpro abstract (IPR022165): | This domain family is found in eukaryotes, and is approximately 140 amino acids in length. The family is found in association with . Polo-like kinase 1 (Plx1) is essential during mitosis for the activation of Cdc25C, for spindle assembly, and for cyclin B degradation. This family is Polo kinase kinase (PKK) which phosphorylates Polo kinase and Polo-like kinase to activate them. PKK is a serine/threonine kinase. |
GO function: | protein serine/threonine kinase activity (GO:0004674) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PKK