The domain within your query sequence starts at position 17 and ends at position 365; the E-value for the PL48 domain shown below is 1.7e-170.

VSRSQSFAGVLGSHERGPRSFTVFSPPGPPRKPLVLSRVSRMFSVAHPAPKVPQPERLDL
VYTALKRGLTAYLEVHQQEQEKLQRQIKESKRNSRLGFLYDLDKQVKSIERFLRRLEFHA
SKIDELYEAYCVQRRLRDGAYNMVRAYSTGSPGSREARDSLAEATRGHREYTESMCLLEN
ELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQRWKLRGRIESSGKQVWDSEETVF
LPLLTEFLSIKVTELKGLANHVVVGSVSCETKDLFAALPQVVAVDINDLGTIKLSLEVIW
SPFDKDDQPSAASTVNKASTVTKRFSTYSQSPPDTPSLREQAFYNMLRR

PL48

PL48
PFAM accession number:PF15903
Interpro abstract (IPR031780):

This entry represents the N-terminal domain of proteins of the FAM65 family (FAM65A, B and C). PL48 (FAM65B, C6orf32) is associated with cytotrophoblast and lineage-specific HL-60 cell differentiation [(PUBMED:9055809)]. The N-terminal part of FAM65B was found to induce the formation of filopodia [(PUBMED:17150207)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PL48