The domain within your query sequence starts at position 1046 and ends at position 1080; the E-value for the PLAC domain shown below is 1.1e-10.

KCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTCRD

PLAC

PLAC
PFAM accession number:PF08686
Interpro abstract (IPR010909):

The PLAC (protease and lacunin) domain is a six-cysteine region of about 40 residues that is present at or near the C-terminal of various enzymes and matrix proteins, including: mammalian PACE4 (paired basic amino acid cleaving enzyme 4), mammalian PCSK5 (proprotein convertase subtilisin/kexin type 5), mammalian metalloproteinases ADAMTS-2, -3, -10, -12, -14, -16, -17, and -19, and manduca Sexta matrix protein lacunin [ (PUBMED:11867212) ]. The PLAC domain is often associated with other domains, such as the thrombospondin type I repeat (TSP1) ( IPR000884 ), the Kunitz proteinase inhibitor domain ( IPR002223 ), the Ig-like domain ( IPR007110 ), the WAP domain ( IPR008197 ), the subtilase domain ( IPR000209 ), or the ADAM-type metalloprotease domain ( IPR001590 ).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLAC