The domain within your query sequence starts at position 1712 and ends at position 1744; the E-value for the PLAC domain shown below is 5.6e-12.

ECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK

PLAC

PLAC
PFAM accession number:PF08686
Interpro abstract (IPR010909):

The PLAC (protease and lacunin) domain is a six-cysteine region of about 40 residues that is present at or near the C-terminal of various enzymes and matrix proteins, including: mammalian PACE4 (paired basic amino acid cleaving enzyme 4), mammalian PCSK5 (proprotein convertase subtilisin/kexin type 5), mammalian metalloproteinases ADAMTS-2, -3, -10, -12, -14, -16, -17, and -19, and manduca Sexta matrix protein lacunin [(PUBMED:11867212)]. The PLAC domain is often associated with other domains, such as the thrombospondin type I repeat (TSP1) (IPR000884), the Kunitz proteinase inhibitor domain (IPR002223), the Ig-like domain (IPR007110), the WAP domain (IPR008197), the subtilase domain (IPR000209), or the ADAM-type metalloprotease domain (IPR001590).

GO function:peptidase activity (GO:0008233)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLAC