The domain within your query sequence starts at position 36 and ends at position 119; the E-value for the PLAC8 domain shown below is 1.9e-21.

WHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSLRTGMRERYHIQ
GSVGHDWAALTFCLPCALCQMARE

PLAC8

PLAC8
PFAM accession number:PF04749
Interpro abstract (IPR006461):

This entry represents a group of cys-rich proteins, including cornifelin and PLAC8 from animals, MCA (MID1-COMPLEMENTING ACTIVITY) and PCR (PLANT CADMIUM RESISTANCE) from Arabidopsis and cell number regulators from maize [(PUBMED:20400678), (PUBMED:21347707)].

Cornifelin is part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia [(PUBMED:15147942), (PUBMED:25377654)]. PLAC8 is required for white adipocyte differentiation in vitro and cell number control in vivo [(PUBMED:23155406)].

Plant transports in this entry include MCA1, MCA2 and PCR1-12. MCA1 and MCA2 mediate Ca2+ uptake [(PUBMED:20097794), (PUBMED:24475319), (PUBMED:21949028)], while PCR2 is a zinc exporter involved in both zinc extrusion and long-distance zinc transport [(PUBMED:20647347)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLAC8