The domain within your query sequence starts at position 956 and ends at position 1062; the E-value for the PLAT domain shown below is 1e-15.

YHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGH
DNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLV

PLAT

PLAT
PFAM accession number:PF01477
Interpro abstract (IPR001024):

This entry represents a domain found in a variety of membrane or lipid associated proteins. It is known as the PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology) domain, is found in a variety of membrane or lipid associated proteins. Structurally, this domain forms a beta-sandwich composed of two sheets of four strands each [(PUBMED:10469604), (PUBMED:11985859), (PUBMED:11412104)]. The most highly conserved regions coincide with the beta-strands, with most of the highly conserved residues being buried within the protein. An exception to this is a surface lysine or arginine that occurs on the surface of the fifth beta-strand of the eukaryotic domains. In pancreatic lipase, the lysine in this position forms a salt bridge with the procolipase protein. The conservation of a charged surface residue may indicate the location of a conserved ligand-binding site. It is thought that this domain may mediate membrane attachment via other protein binding partners.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLAT