The domain within your query sequence starts at position 946 and ends at position 1129; the E-value for the PLC-beta_C domain shown below is 5.1e-68.

HDRADPRVQELKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAREKQAAELKTF
KETSETDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQEVVQAVKQMTE
TLERHQEKLEERQTACLEQIQAMEKQFQEKALAEYEAKMKGLEAEVKESVRAYFKDCFPT
EAED

PLC-beta_C

PLC-beta_C
PFAM accession number:PF08703
Interpro abstract (IPR014815):

This domain corresponds to the alpha helical C-terminal domain of phospholipase C beta (also known a 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta) [(PUBMED:11753430)].

GO process:lipid catabolic process (GO:0016042)
GO function:calcium ion binding (GO:0005509), phosphatidylinositol phospholipase C activity (GO:0004435)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLC-beta_C