The domain within your query sequence starts at position 139 and ends at position 277; the E-value for the PLDc_2 domain shown below is 2.4e-9.
IRKMIKEARKVVAIVMDVFTDVDIFKEIVEASTRGISVYILLDESNFSHFLTMTEKQGCQ IQRLRNIRIRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVMYGSYSYMWSFEKAHLSMV QIITGHLVELFDEEFRTLY
PLDc_2 |
---|
PFAM accession number: | PF13091 |
---|---|
Interpro abstract (IPR025202): | Phospholipase D hydrolyses glycerol-phospholipids at the terminal phosphodiesteric bond. This entry represents a phospholipase D-like domain, found in phospholipase D and related proteins. In cardiolipin synthases it is found duplicated. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLDc_2