The domain within your query sequence starts at position 756 and ends at position 1088; the E-value for the PLU-1 domain shown below is 6e-94.

NEWALNVNEALEAKINKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQ
QLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQQ
SQKLLSEEMPSAAELQELLDVSFEFDVELPQLTEMRIRLEQARWLEEVQQACLDSSSLSL
DDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLRARPRHSLSSLATAVK
EMEEIPAYLPNGTVLKDSVQRARDWVQDVDALQAGGRVPVLETLIELVARGRSIPVHLNS
LPRLEMLVAEVHAWKECAAKTFLPENSTYSLLE

PLU-1

PLU-1
PFAM accession number:PF08429
Interpro abstract (IPR013637):

This domain is found in the central region of lysine-specific demethylases, which are nuclear proteins that may have a role in DNA-binding and transcription, and are associated with malignant cancer phenotypes [(PUBMED:10336460)]. The domain is also found in various other Jumonji/ARID domain-containing proteins (see IPR003347, IPR001606).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLU-1