The domain within your query sequence starts at position 44 and ends at position 133; the E-value for the PMC2NT domain shown below is 2.7e-26.

VAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKV
TELEDKFDLLVDTNDVILERVGMLLDEASG

PMC2NT

PMC2NT
PFAM accession number:PF08066
Interpro abstract (IPR012588):

Exosomes are nano-compartments that function in the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA) [(PUBMED:15951817), (PUBMED:17174896)]. Exosomes occur in both archaea and eukaryotes, and have a similar overall structure to each other and to bacterial/organelle PNPases (polynucleotide phosphorylases; EC 2.7.7.8) [(PUBMED:17084501)], consisting of a barrel structure composed of a hexameric ring of PH domains that act as a degradation chamber, and an S1-domain/KH-domain containing cap that binds the RNA substrate (and sometimes accessory proteins) in order to regulate and restrict entry into the degradation chamber [(PUBMED:16285927)]. There are two types of exosomes in eukaryotes, cytoplasmic exosomes that are responsible for 3'-5' exoribonuclease degradation of mRNAs, and nuclear exosomes that degrade pre-mRNAs (such as nonsense transcripts) and degrade rRNAs, snRNAs and snoRNAs. Unstructured RNA substrates feed in through the pore made by the S1 domains, are degraded by the PH domain ring, and exit as nucleotides via the PH pore at the opposite end of the barrel [(PUBMED:16713559), (PUBMED:17380186)].

There are several accessory proteins that help degrade, unwind or polyadenylate RNA substrate before they enter the exosome. This entry represents the N-terminal domain of Rrp6 (exosome component 10 in humans), a nuclear exosome accessory factor that interacts with the bottom of the hexameric PH-ring opposite the cap. Rrp6 functions as a hydrolytic exonuclease, and is homologous to RNase-D in Escherichia coli.

GO process:RNA processing (GO:0006396)
GO component:nuclear exosome (RNase complex) (GO:0000176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMC2NT